General Information

  • ID:  hor000754
  • Uniprot ID:  P05059
  • Protein name:  Pancreastatin
  • Gene name:  CHGA
  • Organism:  Bos taurus (Bovine)
  • Family:  Chromogranin/secretogranin protein family
  • Source:  animal
  • Expression:  Highest concentration of GE-25 found in adrenal medulla with lower levels present in the pituitary, the intestinal mucosa and the pancreas. Also found in the brain.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Bos (genus), Bovinae (subfamily), Bovidae (family), Pecora (infraorder), Ruminantia (suborder), Artiodactyla (order), Laurasiatheria (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005509 calcium ion binding; GO:0046872 metal ion binding
  • GO BP:  GO:0002551 mast cell chemotaxis; GO:0016525 negative regulation of angiogenesis; GO:0030155 regulation of cell adhesion; GO:0031640 killing of cells of another organism; GO:0033604 negative regulation of catecholamine secretion; GO:0042742 defense response to bacterium; GO:0043303 mast cell degranulation; GO:0045087 innate immune response; GO:0045576 mast cell activation; GO:0046676 negative regulation of insulin secretion; GO:0046888 negative regulation of hormone secretion; GO:0050829 defense response to Gram-negative bacterium; GO:0050830 defense response to Gram-positive bacterium; GO:0050832 defense response to fungus; GO:0086030 adenylate cyclase-activating adrenergic receptor signaling pathway involved in cardiac muscle relaxation; GO:2000707 positive regulation of dense core granule biogenesis
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0030133 transport vesicle; GO:0030141 secretory granule; GO:0031410 cytoplasmic vesicle; GO:0042583 chromaffin granule; GO:0098992 neuronal dense core vesicle

Sequence Information

  • Sequence:  AAPGWPEDGAGKMGAEEAKPPEGKGEWAHSRQEEEEMARAPQVLFRG
  • Length:  47
  • Propeptide:  MRSAAVLALLLCAGQVIALPVNSPMNKGDTEVMKCIVEVISDTLSKPSPMPVSKECFETLRGDERILSILRHQNLLKELQDLALQGAKERTHQQKKHSSYEDELSEVLEKPNDQAEPKEVTEEVSSKDAAEKRDDFKEVEKSDEDSDGDRPQASPGLGPGPKVEEDNQAPGEEEEAPSNAHPLASLPSPKYPGPQAKEDSEGPSQGPASREKGLSAEQGRQTEREEEEEKWEEAEAREKAVPEEESPPTAAFKPPPSLGNKETQRAAPGWPEDGAGKMGAEEAKPPEGKGEWAHSRQEEEEMARAPQVLFRGGKSGEPEQEEQLSKEWEDAKRWSKMDQLAKELTAEKRLEGEEEEEEDPDRSMRLSFRARGYGFRGPGLQLRRGWRPNSREDSVEAGLPLQVRGYPEEKKEEEGSANRRPEDQELESLSAIEAELEKVAHQLEELRRG
  • Signal peptide:  MRSAAVLALLLCAGQVIA
  • Modification:  T30 Phosphoserine;T47 Glycine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Strongly inhibits glucose induced insulin release from the pancreas.
  • Mechanism:  Binds calcium with a low-affinity.
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P05059-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor000754_AF2.pdbhor000754_ESM.pdb

Physical Information

Mass: 589724 Formula: C219H333N65O71S2
Absent amino acids: CINTY Common amino acids: E
pI: 4.47 Basic residues: 7
Polar residues: 8 Hydrophobic residues: 13
Hydrophobicity: -116.6 Boman Index: -10820
Half-Life: 4.4 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 31.49
Instability Index: 6604.47 Extinction Coefficient cystines: 11000
Absorbance 280nm: 239.13

Literature

  • PubMed ID:  2756155
  • Title:  Isolation and characterization of bovine pancreastatin.